PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009103676.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GATA
Protein Properties Length: 315aa    MW: 35196.3 Da    PI: 8.7306
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009103676.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA62.55.1e-20233267135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C++C ttkTp+WR+gp+g+ktLCnaCG+++r+ +l
  XP_009103676.1 233 CTHCETTKTPQWREGPRGPKTLCNACGVRFRSGRL 267
                     *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.8E-19227281IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.105.0E-15231264IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.912231263IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.23E-15231290No hitNo description
CDDcd002027.49E-17232281No hitNo description
PfamPF003208.3E-18233267IPR000679Zinc finger, GATA-type
PROSITE patternPS003440233258IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MQESEWVDKM NNGSWLPEED FKGLTDNFFD DLINHIDFPL EDIETTNEEG DWGADFKNLI  60
PPPSDVLTSL SSEFTRGGTN GNGQRVGAQK KPVPTLKQQS GISSTVETSL PDVKVSKLFQ  120
SSSPVSVLEN AAANGSAASF QNQNRAQRLA FPVKGIRSKR KRPTIPTFLS LHAFLSEMLE  180
KKLALLDDDS DSEDTYNLSS ESSAKKRRKK SNNNSNNSHC PEPFNADGTV RKCTHCETTK  240
TPQWREGPRG PKTLCNACGV RFRSGRLLPE YRPASSPTFI PTVHSNSHRK IIEMRRKEEE  300
GQFVTGMPRG FRYRG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1204208KKRRK
2204209KKRRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.147100.0flower| silique
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009103676.10.0PREDICTED: GATA transcription factor 11 isoform X1
SwissprotQ6DBP81e-102GAT11_ARATH; GATA transcription factor 11
TrEMBLM4D6480.0M4D648_BRARP; Uncharacterized protein
STRINGBra011956.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.28e-86GATA transcription factor 11